P450:CYP51

From Metabolomics.JP
(Difference between revisions)
Jump to: navigation, search
(New page: =51 Family= CYP51s were originally all called CYP51, because only one gene was found per species and they all seemed to be in this one conserved family. However, rice had many CYP51s in a...)
 
 
(13 intermediate revisions by 2 users not shown)
Line 1: Line 1:
 +
{{ {{NAMESPACE}}/Header}}
 +
 
=51 Family=
 
=51 Family=
 +
CYP51 encodes sterol 14alpha-demethylase, an essential enzyme for cholesterol and ergosterol biosynthesis, and is possessed by most fungi, plants, and slime molds. In microbes, it is an important drug target because the inhibition of its activity leads to blocks the synthesis of membrane lipids. On the other hand, nematodes and insects lack this gene.
 +
  
 +
<small>
 +
<span color="red">''The following text is reproduced from Dr. Nelson's page.</span><br/>
 
CYP51s were originally all called CYP51, because only one gene was found per species and they all seemed to be in this one conserved family. However, rice had many CYP51s in at least two sequence groups, so subfamilies have been designated for CYP51s.  These are not the typical subfamilies, but only one subfamily is created for each major taxonomic group.
 
CYP51s were originally all called CYP51, because only one gene was found per species and they all seemed to be in this one conserved family. However, rice had many CYP51s in at least two sequence groups, so subfamilies have been designated for CYP51s.  These are not the typical subfamilies, but only one subfamily is created for each major taxonomic group.
 
* CYP51A for animals,
 
* CYP51A for animals,
Line 15: Line 21:
 
* CYP51H is another group of related sequences that probably do not  
 
* CYP51H is another group of related sequences that probably do not  
 
have the same function as CYP51G.  There are many of these in rice.
 
have the same function as CYP51G.  There are many of these in rice.
 +
</small>
  
{| class="wikitable sortable"
+
{{P450/Table|
! ID !! Species !! Description
+
{{#repeat:P450/Table/Row|1|
+
 
&&CYP51G1&&Arabidopsis thaliana&&GenEMBL AC007296 comp(52507-54167)  
 
&&CYP51G1&&Arabidopsis thaliana&&GenEMBL AC007296 comp(52507-54167)  
 
&&CYP51G1&&Chlamydomonas reinhardtii (green algae)&&GenEMBL ESTs BI717817 BU649818 BI726293 BM001590 BI718677 AV642299
 
&&CYP51G1&&Chlamydomonas reinhardtii (green algae)&&GenEMBL ESTs BI717817 BU649818 BI726293 BM001590 BI718677 AV642299
Line 34: Line 39:
 
&&CYP51G1&&Oryza sativa (rice)&&GenEMBL aaaa01012243.1 Indica rice genome  
 
&&CYP51G1&&Oryza sativa (rice)&&GenEMBL aaaa01012243.1 Indica rice genome  
 
&&CYP51G1&&Pinus taeda (pine)&&GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
 
&&CYP51G1&&Pinus taeda (pine)&&GenEMBL BF517195.1 AW984874.1 AW626637.1 C-term fragments
&&CYP51&&C-term&&LXHDVLAXXDVLYRCIKEALRLHPPLIVLLRSNHRDFTVTAKDGKDYVIPKGHVVATSPAFANRLPHIFKNPDT
 
 
&&CYP51G1&&Sorghum bicolor&&GenEMBL U74319
 
&&CYP51G1&&Sorghum bicolor&&GenEMBL U74319
 
&&CYP51G1&&Triticum aestivum (wheat)&&GenEMBL Y09291 (1655bp)
 
&&CYP51G1&&Triticum aestivum (wheat)&&GenEMBL Y09291 (1655bp)
Line 85: Line 89:
 
&&CYP55B1&&Chlamydomonas reinhardtii&&See Chlamy page
 
&&CYP55B1&&Chlamydomonas reinhardtii&&See Chlamy page
 
}}
 
}}
|}
 

Latest revision as of 00:30, 25 June 2009

P450 Top
(P450トップ)
P450 Index
(P450一覧)
Arabidopsis
(シロイヌナズナ)
Oryza
(イネ)

Species-sequence information is taken from Cytochrome P450 Homepage by Dr. Nelson. (last update 2009/06/20)

[edit] 51 Family

CYP51 encodes sterol 14alpha-demethylase, an essential enzyme for cholesterol and ergosterol biosynthesis, and is possessed by most fungi, plants, and slime molds. In microbes, it is an important drug target because the inhibition of its activity leads to blocks the synthesis of membrane lipids. On the other hand, nematodes and insects lack this gene.


The following text is reproduced from Dr. Nelson's page.
CYP51s were originally all called CYP51, because only one gene was found per species and they all seemed to be in this one conserved family. However, rice had many CYP51s in at least two sequence groups, so subfamilies have been designated for CYP51s. These are not the typical subfamilies, but only one subfamily is created for each major taxonomic group.

  • CYP51A for animals,
  • CYP51B for bacteria,
  • CYP51C for Chromista,
  • CYP51D for Dictyostelium,
  • CYP51E for Euglenozoa,
  • CYP51F for fungi.

Those groups with only one CYP51 per species are all called by one name:

  • CYP51A1 is for all animal CYP51s since they are orthologous.
  • The same is true for CYP51B, C, D, E and F.
  • CYP51G (green plants) and CYP51Hs (monocots only so far) have individual sequence numbers.
  • CYP51G1 refers to the typical CYP51 14 alpha-demethylase gene in plants, usually in one copy per species. A few species have extra CYP51G sequences.
  • CYP51H is another group of related sequences that probably do not

have the same function as CYP51G. There are many of these in rice.


<<First Family   <Previous Family

Next Family>   Last Family>>


[edit] Functions

  • CYP51, sterol 14-demethylase; obtusifoliol-14alpha-demethylase,


[edit] Links

  • CYPedia CYP51 Functional Prediction (Cytochrome P450 Expression Database using Arabidopsis) by IBMP Strasbourg.
Personal tools
Namespaces

Variants
Actions
Navigation
metabolites
Toolbox